Web Analysis for Projectfromzero - projectfromzero.com
2.40
Rating by CuteStat
projectfromzero.com is 7 years 10 months old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, projectfromzero.com is SAFE to browse.
PageSpeed Score
44
Siteadvisor Rating
Not Applicable
Traffic Report
Daily Unique Visitors: | Not Applicable |
Daily Pageviews: | Not Applicable |
Estimated Valuation
Income Per Day: | $ 0.15 |
Estimated Worth: | $ 8.95 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Safety Information
Google Safe Browsing: | Not Applicable |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Alexa Rank: | Not Applicable |
Domain Authority: | Not Applicable |
Web Server Information
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | 1 | H2 Headings: | 7 |
H3 Headings: | 3 | H4 Headings: | 2 |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | 3 |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 184.175.95.2)
Family Law Attorney Services : Johnson Law
- familylawlawyerfayettevillenc.com
Johnson law practices family law in Wilmington, NC. We handle cases that consist of child custody to divorces.
Not Applicable
$
8.95
Armando Luna - Technology Consultant | websites, hosting, custom softw
- coolmando.com
Not Applicable
$
8.95
HTTP Header Analysis
HTTP/1.1 200 OK
Date: Fri, 08 Sep 2017 23:35:46 GMT
Server: Apache
X-Powered-By: PHP/5.5.38
Link: <https://projectfromzero.com/index.php?rest_route=/>; rel="https://api.w.org/"
Content-Length: 40088
Content-Type: text/html; charset=UTF-8
Date: Fri, 08 Sep 2017 23:35:46 GMT
Server: Apache
X-Powered-By: PHP/5.5.38
Link: <https://projectfromzero.com/index.php?rest_route=/>; rel="https://api.w.org/"
Content-Length: 40088
Content-Type: text/html; charset=UTF-8
Domain Information
Domain Nameserver Information
Host | IP Address | Country | |
---|---|---|---|
ns3.hostek.com | 173.245.58.12 | United States of America | |
ns4.hostek.com | 173.245.59.13 | United States of America |
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
projectfromzero.com | A | 14390 |
IP: 184.175.95.2 |
projectfromzero.com | NS | 86399 |
Target: ns3.hostek.com |
projectfromzero.com | NS | 86399 |
Target: ns4.hostek.com |
projectfromzero.com | SOA | 86399 |
MNAME: ns3.hostek.com RNAME: cpanel.hostek.com Serial: 2016052703 Refresh: 3600 Retry: 7200 Expire: 1209600 Minimum TTL: 86400 |
projectfromzero.com | MX | 14399 |
Target: projectfromzero.com |
projectfromzero.com | TXT | 14399 |
TXT: v=spf1 +a +mx +ip4:184.175.95.2 ~all |
Full WHOIS Lookup
Domain Name: PROJECTFROMZERO.COM
Registry Domain ID: 2031576156_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.name.com
Registrar URL: http://www.name.com
Updated Date: 2017-05-01T16:40:16Z
Creation Date: 2016-05-27T16:36:21Z
Registry Expiry Date: 2018-05-27T16:36:21Z
Registrar: Name.com, Inc.
Registrar IANA ID: 625
Registrar Abuse Contact Email: abuse@name.com
Registrar Abuse Contact Phone: 7202492374
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: NS3.HOSTEK.COM
Name Server: NS4.HOSTEK.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2017-09-08T23:35:58Z
Registry Domain ID: 2031576156_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.name.com
Registrar URL: http://www.name.com
Updated Date: 2017-05-01T16:40:16Z
Creation Date: 2016-05-27T16:36:21Z
Registry Expiry Date: 2018-05-27T16:36:21Z
Registrar: Name.com, Inc.
Registrar IANA ID: 625
Registrar Abuse Contact Email: abuse@name.com
Registrar Abuse Contact Phone: 7202492374
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: NS3.HOSTEK.COM
Name Server: NS4.HOSTEK.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2017-09-08T23:35:58Z